Lured to Australia by Alfred Deakin in 1887, the Chaffey Brothers were American irrigation engineers who took up a challenge to develop the dust bowls ofRenmark and Mildura into fruit growing wonderlands. They left our nation an extraordinary legacy and their progeny continue to make good wine. Several generations later, the Chaffey Bros are focused on the fruit of some grand old Barossa and Eden Valley sites. Chosen harvests of extraordinary grapes are the ticket for admission into the exclusive club of Chaffey vineyards. Shiraz is made in several different styles and there's a penchant for obscure white varietals in the Mosel River way. They make wine according to the art of the Parfumier, nothing is bottled unless it represents a profound experience in aromatic complexity. The transcendental excellence of superior little parcels, the myriad enunciations of season, terroir and clime...
A splendour of salient sites»
PLUSummerfieldpicswinerywidgetsslidesthumbswineryAccademia Dei Racemi
Moet & Chandon originally acquired the Green Point property, an old dairy farm at Coldstream along Maroondah Highway, with a vision of establishing a prestigious Australian label. Set in the verdant hills of Victoria's propitious Yarra Valley, Domain Chandon continue to over deliver, completely dedicated to the production of the finest quality, cool climate table wines. The excellence of their renowned sparklings are due in no small part to the quality of the estate's Chardonnay and Pinot Noir. A regimen of extravagant Burgundian techniques, achieve a range of superlative Yarra Valley table..
These old yarra valley vines are just getting better»