• Delivery
Wine clubWine clubWine clubWine club
  • Gift registry
  • Wishlist
  • FAQs
Moet & Chandon originally acquired the Green Point property, an old dairy farm at Coldstream along Maroondah Highway, with a vision of establishing a prestigious Australian label. Set in the verdant hills of Victoria's propitious Yarra Valley, Domain Chandon continue to over deliver, completely dedicated to the production of the finest quality, cool climate table wines. The excellence of their renowned sparklings are due in no small part to the quality of the estate's Chardonnay and Pinot Noir. A regimen of extravagant Burgundian techniques, achieve a range of superlative Yarra Valley table.. These old yarra valley vines are just getting better»
PLUWirrasardinePennysHillthumbswinerytileswidgetspicsnavfaqspng
1 - 0 of 0